PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn352311
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family LBD
Protein Properties Length: 676aa    MW: 75433 Da    PI: 8.0396
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn352311genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26079.55.4e-2550358024101
      DUF260  24 aeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkeel 101
                 a+ p++fa++hk+FGasnv+kll ++p  +r +a+ +++yeA+ar+rdPvyG+v++i++lqqq+++l+a+l ++k++l
  Achn352311 503 AQGPAQFAAIHKVFGASNVSKLLLHVPVPDRCEAVVTITYEAQARMRDPVYGCVAHIFALQQQVACLQAQLMQVKAQL 580
                 45599******************************************************************9999875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:3.30.1740.102.8E-45389IPR001510Zinc finger, PARP-type
SuperFamilySSF577161.05E-1997189No hitNo description
Gene3DG3DSA:3.30.1740.101.3E-2397196IPR001510Zinc finger, PARP-type
PROSITE profilePS5006416.046101173IPR001510Zinc finger, PARP-type
SMARTSM013365.8E-23104178IPR001510Zinc finger, PARP-type
PfamPF006451.9E-16104175IPR001510Zinc finger, PARP-type
SuperFamilySSF1429211.15E-9266315IPR008893WGR domain
PfamPF054062.5E-7269316IPR008893WGR domain
Gene3DG3DSA:1.20.142.104.7E-25314443IPR004102Poly(ADP-ribose) polymerase, regulatory domain
PROSITE profilePS5106019.329333461IPR004102Poly(ADP-ribose) polymerase, regulatory domain
PfamPF028777.6E-23334443IPR004102Poly(ADP-ribose) polymerase, regulatory domain
SuperFamilySSF475871.83E-20335443IPR004102Poly(ADP-ribose) polymerase, regulatory domain
PfamPF006441.2E-10441504IPR012317Poly(ADP-ribose) polymerase, catalytic domain
SuperFamilySSF563991.63E-9442506No hitNo description
Gene3DG3DSA:3.90.228.101.2E-12444504IPR012317Poly(ADP-ribose) polymerase, catalytic domain
PROSITE profilePS5089112.875477580IPR004883Lateral organ boundaries, LOB
PfamPF031955.4E-24502577IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006471Biological Processprotein ADP-ribosylation
GO:0003677Molecular FunctionDNA binding
GO:0003950Molecular FunctionNAD+ ADP-ribosyltransferase activity
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 676 aa     Download sequence    Send to blast
MEGIGKGDSR STRNFCPRNL STIFQKDFHS ISSSNSSSSS KNYIYSDALI NDCTEESAFE  60
AANLDDVEGI ELLRWEDQQK IRKYVEVGGP QYTPSAAVME YGIEVSQTSR ATCRHCNQKI  120
MKGEVRISTK PDGQGARGLA WHHANCFMEL FPTTQVENVS GWNNLSAADQ AAILALVKNP  180
PSSRKDIKVE QQEDKESLQQ PASKGGSKRK KAVSYDQKAK LAKCESGAFM REGDMQDEWK  240
NQIEGAGGQV HTKIKKDTNC LVVSGLLDDK NAEMKAASYY ILQIIQEDKG SCCYVFRKWG  300
RVGNKKIGGI KLDEMDYGVN KEVSKKKNLN DAGSLLAPPL KELIKMLFNV EAYRICFIYI  360
QFCRSAMMEF EINMSEMPLG KLSKSNIQKG FEALTEIQNL VTSNVHDPSY KESLIIDASN  420
RFFTVIPSIH PHVIRDEDDL KSKYMDKPPQ GKHSTKGLGL KIPQQSEHAK WRDEVVVPCG  480
KPVASNIKAS ELMYNEYIVY NTAQGPAQFA AIHKVFGASN VSKLLLHVPV PDRCEAVVTI  540
TYEAQARMRD PVYGCVAHIF ALQQQVACLQ AQLMQVKAQL AQNLIDTRQV ENQIWPGNMV  600
AMPNFPTYAN PTCMSLSSIC PQSSLESIGR GNVDGLGGQE RERREEFCFQ TCTKKRPSQT  660
DFGELQALAL RMMRN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dqy_C1e-2127842752225Poly [ADP-ribose] polymerase 1
4dqy_F1e-2127842752225Poly [ADP-ribose] polymerase 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
SwissprotQ9ZP546e-63PARP1_ARATH; Poly [ADP-ribose] polymerase 1
STRINGVIT_07s0005g03040.t012e-70(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4324669
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G42430.18e-33lateral organ boundaries-domain 16